PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015881405.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 238aa    MW: 26906 Da    PI: 7.4552
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015881405.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS182.13.9e-561237129374
            GRAS 129 lqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl..eleeLrvkpgEalaVnlvlqlhrlldesvsle 221
                     +q+L  R++g+psl+iT+++sp++++  el  ++e+L++fA+e+g++fe +v   + le+   +l+ ++++++Ea+aVn+ +   +   ++++l+
  XP_015881405.1   1 MQELPLRNRGTPSLKITAFASPSTHHPVELGLMKENLTQFANEIGISFELEVCNFDILEQTsyTLSVFQTNENEAVAVNFPIWSSSS--QPAALP 93 
                     8**************************************************975554444422667778888********9955444..688888 PP

            GRAS 222 serdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekW 315
                     +    +L+++k+lsP++vv  ++ +d+ + +F +++l+al+ y  l++sl ++++   s++ +k+Er+ll+++i++ v  + ++      ++  W
  XP_015881405.1  94 N----LLRFIKQLSPRIVVSLDRGCDRFDLPFPQHILQALQSYIILLESLdAVNV--PSDALNKIERFLLQPSIESTVLGRLRA----PDKMPLW 178
                     8....*********************************************55555..678899****************99998....999**** PP

            GRAS 316 rerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +  + +aGF+p+++s+++++qa++++++++ +g++ve++++slvl+W++r+L+s+SaWr
  XP_015881405.1 179 KTLFASAGFTPLTFSNFTETQAECVVKRTPARGFHVEKRQASLVLYWQRRELISASAWR 237
                     **********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035141.4E-531237IPR005202Transcription factor GRAS
PROSITE profilePS5098523.1711217IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MQELPLRNRG TPSLKITAFA SPSTHHPVEL GLMKENLTQF ANEIGISFEL EVCNFDILEQ  60
TSYTLSVFQT NENEAVAVNF PIWSSSSQPA ALPNLLRFIK QLSPRIVVSL DRGCDRFDLP  120
FPQHILQALQ SYIILLESLD AVNVPSDALN KIERFLLQPS IESTVLGRLR APDKMPLWKT  180
LFASAGFTPL TFSNFTETQA ECVVKRTPAR GFHVEKRQAS LVLYWQRREL ISASAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-131237128375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881405.11e-176PREDICTED: scarecrow-like protein 6
RefseqXP_015881407.11e-169PREDICTED: scarecrow-like protein 22
SwissprotO813161e-78SCL6_ARATH; Scarecrow-like protein 6
TrEMBLM5WE331e-145M5WE33_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s00480.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132692130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.16e-80GRAS family protein